glucagon-like peptide 1

glucagon-like peptide 1
1) pйptido-1 anбlogo al glucagуn
2) GLP-1

English-Spanish medical dictionary . 2013.

Игры ⚽ Нужно сделать НИР?

Mira otros diccionarios:

  • Glucagon-like peptide-1 — (GLP 1) is derived from the transcription product of the proglucagon gene. The major source of GLP 1 in the body is the intestinal L cell that secretes GLP 1 as a gut hormone. The biologically active forms of GLP 1 are: GLP 1 (7 37) and GLP 1 (7… …   Wikipedia

  • Glucagon-like-peptide 1 — Masse/Länge Primärstruktur 37 Aminosäuren …   Deutsch Wikipedia

  • Glucagon-like peptide-2 — (GLP 2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP 2 is created by specific post translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon like… …   Wikipedia

  • glucagon-Like Peptide — péptido derivado del proglucagón dotado de potentes propiedades insulinotrópicas Diccionario ilustrado de Términos Médicos.. Alvaro Galiano. 2010 …   Diccionario médico

  • Glucagon-like peptide 1 receptor — The glucagon like peptide 1 receptor (GLP1R) is a human gene which resides on chromosome 6.cite journal | author = Thorens B | title = Expression cloning of the pancreatic beta cell receptor for the gluco incretin hormone glucagon like peptide 1… …   Wikipedia

  • Glucagon-like peptide 2 receptor — The gene for the glucagon like peptide 2 receptor (GLP 2) is on chromosome 17.cite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon receptor family of G protein coupled receptors: the glucagon, GIP, GLP 1,… …   Wikipedia

  • glucagon-like peptide — (GLP) either of two intestinal peptide hormones (GLP 1 and GLP 2) secreted by the L cells in response to ingestion of nutrients, especially carbohydrates and fat rich meals. GLP 1 inhibits gastric emptying, food intake, and glucagon secretion and …   Medical dictionary

  • Glucagon — is an important hormone involved in carbohydrate metabolism. Produced by the pancreas, it is released when the glucose level in the blood is low (hypoglycemia), causing the liver to convert stored glycogen into glucose and release it into the… …   Wikipedia

  • Glucagon receptor family — The glucagon receptor familycite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon receptor family of G protein coupled receptors: the glucagon, GIP, GLP 1, and GLP 2 receptors | journal = Recept. Channels |… …   Wikipedia

  • Glucagon receptor — The glucagon receptor is a 62 kDa peptide that is activated by glucagon and is a member of the G protein coupled family of receptors, coupled to Gs.cite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon… …   Wikipedia

  • Glucagon hormone family — Pfam box Symbol = Hormone 2 Name = width = caption = Glucagon (PDB3|1gcn) Pfam= PF00123 InterPro= IPR000532 SMART= Prosite = PDOC00233 SCOP = 1gcn TCDB = OPM family= OPM protein= 1gcn PDB=PDB3|1geaA:132 151 PDB3|1d0rA:98 125 PDB3|1jrjA:48… …   Wikipedia

Compartir el artículo y extractos

Link directo
Do a right-click on the link above
and select “Copy Link”